Check Link

Type URL of your website to get quantity of backlinks from homepage - homepage to your website. It will show you total outbound links, inbound links on that page and follow domain for each of your inbound links, outbound links available.

kidsgameshq.com

Out-link is a link that points from your website to another website. These are out-links list of kidsgameshq.com ( 6 ) View all

javascriptvoidaddbookmarkkidsgamesplayfreekidsgamesonlinekidsgameshq.comCheck link
mathgameshq.comCheck link
drawinggamesonline.orgCheck link
fungameshq.comCheck link
topwordgames.comCheck link
onlinetypinggames.orgCheck link

In-Links : Another name for backlinks, or links into a domain from external sources.These are in-links list of kidsgameshq.com ( 0 ) View all