Check Link

Type URL of your website to get quantity of backlinks from homepage - homepage to your website. It will show you total outbound links, inbound links on that page and follow domain for each of your inbound links, outbound links available.

codemoot.com

Out-link is a link that points from your website to another website. These are out-links list of codemoot.com ( 96 ) View all

sex.politicdifferent.comCheck link
business.liveoakrealestatelistings.comCheck link
travel.metatrader-toolkit.comCheck link
money.lakeviewalspeedingticketattorney.comCheck link
www.codemoot.comCheck link
music.find-your-light.comCheck link
show.kings-church.comCheck link
usa.683548.comCheck link
news.filopratica.comCheck link
internet.ucshec.comCheck link

In-Links : Another name for backlinks, or links into a domain from external sources.These are in-links list of codemoot.com ( 0 ) View all